Protein Info for Echvi_3106 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Sugar phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 326 to 342 (17 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 381 to 406 (26 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 399 (379 residues), 169.9 bits, see alignment E=7.4e-54 PF00083: Sugar_tr" amino acids 58 to 436 (379 residues), 37 bits, see alignment E=2e-13

Best Hits

KEGG orthology group: None (inferred from 57% identity to sli:Slin_1058)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZI1 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Echvi_3106 Sugar phosphate permease (Echinicola vietnamensis KMM 6221, DSM 17526)
MVKIKLNSIIKGYRWRIVALLFLATAIKYIDRNVLSFTMIDEGFRREMLGVSDTTALSSE
LIGKFKILMGYVDASFKFAYAIGFVLMGYFIDRVLVRKGYSIAIAIWSLAGIVTAFVSSF
RGLSFTRFVFGFGESANFPAAIKTIAEWFPKKERSFATGIYNAGANVGIMATVLIVPALI
LNLGWRWSFLCTGLLGLVLLACWLLIYKPPKAHPKVSQDEQEHIHADEESEHEAEKVPWK
DLLKTKGAWAIALGKFLTDPIWWFYLTWLPDFFNSNEALETKLDLTGLALPFIFIYFTSD
LGSVFFGWLSGKFINMGWSLNKSRKVTLLLCALLVVPLIFAAKVANVYVAMVLVALAAAA
HQGWSANLFTLSSDIFPKRVVGSVVGLAGMVGGIGGTIFAAFAGIILVKWGYFPIFIIAS
SAYLLAWLIIHLLVPKIGVRS