Protein Info for Echvi_3097 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: MIP family channel proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details PF00230: MIP" amino acids 2 to 220 (219 residues), 170.8 bits, see alignment E=2e-54 TIGR00861: MIP family channel proteins" amino acids 6 to 220 (215 residues), 191.7 bits, see alignment E=7.6e-61

Best Hits

Swiss-Prot: 75% identical to AQPZ_VIBVU: Aquaporin Z (aqpZ) from Vibrio vulnificus (strain CMCP6)

KEGG orthology group: K06188, aquaporin Z (inferred from 81% identity to fbc:FB2170_08014)

MetaCyc: 71% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3A9 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Echvi_3097 MIP family channel proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKLIAEFIGTFWLVLGGCGSAVLAAAFPELGIGFAGVALAFGLTVLTMAYAIGHVSGCH
LNPAVSIGLWAGGRFEAKELLPYILAQVLGGLVAAAVLYVIASDNPAFELGGFAANGYGE
HSPGGYGMTAALVTEVVMTFAFLFVILGATHSKAPQGLAGVAIGLCLTLIHLISIPVTNT
SVNPARSTSQAIFVGDWALGQLWLFWVAPIVGAILAGWVYKYLSPEK