Protein Info for Echvi_3082 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Pectin methylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01095: Pectinesterase" amino acids 44 to 326 (283 residues), 260.5 bits, see alignment E=5.1e-81 PF13229: Beta_helix" amino acids 126 to 240 (115 residues), 28.7 bits, see alignment E=3.4e-10 PF00135: COesterase" amino acids 390 to 495 (106 residues), 42.7 bits, see alignment E=1.4e-14 PF20434: BD-FAE" amino acids 392 to 572 (181 residues), 135.4 bits, see alignment E=7.3e-43 PF07859: Abhydrolase_3" amino acids 407 to 499 (93 residues), 77.7 bits, see alignment E=4e-25 PF00326: Peptidase_S9" amino acids 428 to 496 (69 residues), 27.4 bits, see alignment E=8e-10

Best Hits

Predicted SEED Role

"rhamnogalacturonan acetylesterase" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G397 at UniProt or InterPro

Protein Sequence (631 amino acids)

>Echvi_3082 Pectin methylesterase (Echinicola vietnamensis KMM 6221, DSM 17526)
MLRHQITTVFLLAFSVMTGLQAQHVNSYPKDGKVRDLKGKVQEDIVVAKDGSGDFLYIAD
ALEAIRVYLPKPITVHIKEGVYKEKLEIPGTITNVTFKGDGPGKTIITYDDHTGKDYMDT
FDSYTLLVWGNSLTFKDMTIQNTAGSVGQAVALHAEGDRLVFENCHFRGDQDTMFASGEN
SRQYFKDCYIEGTTDFIFGGATALFEDCEIHSKSNSYITAASTSEWVKFGYVFKNCRLTA
AEGVEKVYLGRPWRDFAKTVFINCEMGSHIVPEGWHNWGREETEKTTFYAEYGSYGPGAN
RSARATWSHQLADEEADAYTIANIFAGHTCPKGAYGFPWYGYAVDSSFNLDDSYEKYKKY
FPDIQPVSNVAIEGVETTNVKYKDLGYRSLEMDVFYPEEKSKLPGILLVHGGGWRSGNRS
LQAPLAKALAKRGYVTAVMDYRLSLEAPYPAGVYDVKDAVKWLKSHADNFGLDTSRVAIS
GGSAGGQLAALVAMTNGRLAYEETNNGDQHASSTVQALIDMDGVLAFHHPESSEGEVAAQ
WLGGTYDEVPAIWEAASALHQVSERAVPSLFLNSQYPRFHAGQDDLIQQLDQRGIYSEVH
GFERSPHPFWLFNPWFEQTVDYVDSFLKSVW