Protein Info for Echvi_3073 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF00356: LacI" amino acids 8 to 53 (46 residues), 53.5 bits, see alignment 3.2e-18 PF13407: Peripla_BP_4" amino acids 67 to 315 (249 residues), 72.9 bits, see alignment E=6.3e-24 PF00532: Peripla_BP_1" amino acids 67 to 308 (242 residues), 122.5 bits, see alignment E=4.9e-39 PF13377: Peripla_BP_3" amino acids 175 to 338 (164 residues), 104.7 bits, see alignment E=1.2e-33

Best Hits

KEGG orthology group: None (inferred from 51% identity to fbc:FB2170_15063)

Predicted SEED Role

"Hexuronate utilization operon transcriptional repressor ExuR" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2T3 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Echvi_3073 Transcriptional regulators (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKRKKATIHDIASKLGITASTVSRALNNHPRISDATKKLVTKTAKDINYQPNNIAAALR
NGKSRLIGIIVPTANRNFFSSVVRGIEEIANQLNYKVIISQSYENYEQEVQIVDTLLSAR
VDGIIMSIGKNTEDFDHLERIVDKSIPLVLFDRITDDVEVNQVVIDDYMGAYKSVEHLIE
NGYKRIAHFTNPRKINIYSERLRGYIDALHNHGIPFDKKLIIESNMQLEDGQRSVLKMLD
EGLDFDAIFSSSDYAAMGALQMLKEKNINVPEQVGLVGFGNEPFTSFTTPSLTTVDQVSI
PMGNVAAELFFELLKADPKKYVPQKTVLKPELIIRESSARKVAQPLNK