Protein Info for Echvi_3071 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Mannitol-1-phosphate/altronate dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF01232: Mannitol_dh" amino acids 18 to 257 (240 residues), 131.8 bits, see alignment E=3.4e-42 PF08125: Mannitol_dh_C" amino acids 275 to 465 (191 residues), 124.2 bits, see alignment E=4.8e-40

Best Hits

Swiss-Prot: 57% identical to UXAB_CLOAB: Altronate oxidoreductase (uxaB) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

KEGG orthology group: K00041, tagaturonate reductase [EC: 1.1.1.58] (inferred from 58% identity to amt:Amet_0555)

MetaCyc: 49% identical to tagaturonate reductase (Escherichia coli K-12 substr. MG1655)
Tagaturonate reductase. [EC: 1.1.1.58]

Predicted SEED Role

"Altronate oxidoreductase (EC 1.1.1.58)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.58)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.58

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZE8 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Echvi_3071 Mannitol-1-phosphate/altronate dehydrogenases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTLNRQTVDGITERPVKVLQFGEGNFLRGFVDWIIDTMNEKTDFNGDVQLVQPIQHGMG
KMINDQEGLYHVQLSGIQKGEAKEETRLITCVRGVVNPYESYEAYLKLAENLDLRFVVSN
TTEAGISYNPEDDDREKLPSSFPGKLTALLYKRFDTFNGDKAKGLHIIPCELIDKNGAKL
KEIILQYAALWQLPNGFIQWINEANTFSNTLVDRIVPGFPKETIKEIQENIGYEDNLVVK
AEPFHLWVIEGLDAVKAEFPAEEAGLDVKFVKDQSPYRTRKVRILNGAHTSLVPVAYLHG
LRTVRESVEDPVIGPFLNETIQGEIIPTLDLPKEELEQFANDVMDRFKNPFVKHLLSSIA
LNSISKFKVRVLPSLLEYVDRKGKLPSNLVRSLAALIVFYKGSYNGEATPVQDDEEIVNY
FKTIWESDDLDEAAGEVLKNVNFWDTDLTKVEGLQAAVSEQLSQLVDKEKV