Protein Info for Echvi_3063 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: FeS assembly ATPase SufC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR01978: FeS assembly ATPase SufC" amino acids 2 to 244 (243 residues), 376.1 bits, see alignment E=3.4e-117 PF00005: ABC_tran" amino acids 17 to 172 (156 residues), 87.8 bits, see alignment E=5.2e-29

Best Hits

Swiss-Prot: 66% identical to SUFC_ECOLI: Probable ATP-dependent transporter SufC (sufC) from Escherichia coli (strain K12)

KEGG orthology group: K09013, Fe-S cluster assembly ATP-binding protein (inferred from 82% identity to chu:CHU_0977)

Predicted SEED Role

"Iron-sulfur cluster assembly ATPase protein SufC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2S2 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Echvi_3063 FeS assembly ATPase SufC (Echinicola vietnamensis KMM 6221, DSM 17526)
MLSIKNLHASIEGTPILKGINLEIKPGEVHAIMGPNGSGKSTLASVLAGREEYEVTDGEV
TFNGKDLLEMNPEDRAREGVFLAFQYPVEIPGVSTTNFLRTAVNQVREYRGQEALDAVKF
LSLMKEKMKLVEIDQKLMSRALNEGFSGGEKKRNEIFQMAMLEPTLSILDETDSGLDIDA
LKIVSNGVNQLKSKDNATIVVTHYQRLLDYIVPDYVHVLYKGRIVKSGSKELALDLEENG
YDWIKADVDGASV