Protein Info for Echvi_3061 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: cysteine desulfurases, SufS subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01979: cysteine desulfurase, SufS family
  • amino acids 7 to 404 (398 residues), 589.5 bits, E=1.6e-181
• PF00266: Aminotran_5
  • amino acids 25 to 394 (370 residues), 500.9 bits, E=2.2e-154
• PF00155: Aminotran_1_2
  • amino acids 67 to 245 (179 residues), 32.7 bits, E=4.9e-12

Best Hits

Swiss-Prot: 51% identical to CSD_BACHD: Probable cysteine desulfurase (csd) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 63% identity to dfe:Dfer_5780)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (5/6 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• superpathway of L-alanine biosynthesis (2/4 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
• molybdopterin biosynthesis (2/6 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (2/11 steps found)

KEGG Metabolic Maps

• Selenoamino acid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Sequence Analysis Tools

See L0FZE1 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Echvi_3061 cysteine desulfurases, SufS subfamily (Echinicola vietnamensis KMM 6221, DSM 17526)
MTLNTEHIRGQFPVLHQEVNGKPLIYMDNAATTQKPTRVLEALSAYYTHDNSNIHRGAHT
LADRATRHYEKTRGQVKEFINAAEDEEVIFTKGTTEGINLVAATFGRKFIEKGDEIIIST
LEHHSNIVPWQMLCEEKGAKLKVIPINEKGELLMEAFDDMLNEKTKLVAVVHASNALGTI
NPVKEIIEKSHKVGAKVLIDGAQSSAHLDIDVQALDCDFFVMSAHKIYGPTGLGVLYGKR
EILEAMPPYQGGGEMIKEVTFEKTTFNDIPFKFEAGTPNIADVIAFQKALEFVNEIGKSA
IRAHEEKLLQHAMTQLNDIKGFIPVGTADQKVSVLSFLINDMHPFDVGMMLDAAGIAVRT
GHHCTQPLMGRFNIEGTVRASFSVYNTKEEVDKLCESVRKIAKLKNK