Protein Info for Echvi_3061 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: cysteine desulfurases, SufS subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 TIGR01979: cysteine desulfurase, SufS family" amino acids 7 to 404 (398 residues), 589.5 bits, see alignment E=1.6e-181 PF00266: Aminotran_5" amino acids 25 to 394 (370 residues), 498.4 bits, see alignment E=1.3e-153 PF00155: Aminotran_1_2" amino acids 67 to 245 (179 residues), 32.7 bits, see alignment E=4.9e-12

Best Hits

Swiss-Prot: 51% identical to CSD_BACHD: Probable cysteine desulfurase (csd) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 63% identity to dfe:Dfer_5780)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZE1 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Echvi_3061 cysteine desulfurases, SufS subfamily (Echinicola vietnamensis KMM 6221, DSM 17526)
MTLNTEHIRGQFPVLHQEVNGKPLIYMDNAATTQKPTRVLEALSAYYTHDNSNIHRGAHT
LADRATRHYEKTRGQVKEFINAAEDEEVIFTKGTTEGINLVAATFGRKFIEKGDEIIIST
LEHHSNIVPWQMLCEEKGAKLKVIPINEKGELLMEAFDDMLNEKTKLVAVVHASNALGTI
NPVKEIIEKSHKVGAKVLIDGAQSSAHLDIDVQALDCDFFVMSAHKIYGPTGLGVLYGKR
EILEAMPPYQGGGEMIKEVTFEKTTFNDIPFKFEAGTPNIADVIAFQKALEFVNEIGKSA
IRAHEEKLLQHAMTQLNDIKGFIPVGTADQKVSVLSFLINDMHPFDVGMMLDAAGIAVRT
GHHCTQPLMGRFNIEGTVRASFSVYNTKEEVDKLCESVRKIAKLKNK