Protein Info for Echvi_3060 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: SufE protein probably involved in Fe-S center assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF02657: SufE" amino acids 13 to 131 (119 residues), 128 bits, see alignment E=8.4e-42

Best Hits

Swiss-Prot: 38% identical to Y1250_RHIEC: Uncharacterized SufE-like protein RHE_CH01250 (RHE_CH01250) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K02426, cysteine desulfuration protein SufE (inferred from 53% identity to mtt:Ftrac_0911)

Predicted SEED Role

"Sulfur acceptor protein SufE for iron-sulfur cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1V6 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Echvi_3060 SufE protein probably involved in Fe-S center assembly (Echinicola vietnamensis KMM 6221, DSM 17526)
MSDIKQVQEEIIDEFSILEGDRESTIFYIMELGNQLDAFPEEARLDENLIKGCQSKVWLT
TEIKDQKIIFKADSNTDITKGLISLLIRVLSGRSPKEIIDEDLYFIEKIGMGNIIGSQRS
NGLASMIKQMKLYALAYQSKLNV