Protein Info for Echvi_3059 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: FeS assembly SUF system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 TIGR02945: FeS assembly SUF system protein" amino acids 16 to 113 (98 residues), 143.6 bits, see alignment E=1e-46 PF01883: FeS_assembly_P" amino acids 17 to 90 (74 residues), 68.9 bits, see alignment E=1.8e-23

Best Hits

Swiss-Prot: 38% identical to SUFT_BACSU: Fe-S protein maturation auxiliary factor YitW (yitW) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 70% identity to mtt:Ftrac_0912)

Predicted SEED Role

"PaaD-like protein (DUF59) involved in Fe-S cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G164 at UniProt or InterPro

Protein Sequence (113 amino acids)

>Echvi_3059 FeS assembly SUF system protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSEENQTAQPANIPDLRDKVIQAIKLVYDPEIPVDVYELGLIYEISVFPVNNVYVLMTLT
SPNCPSAESIPAEVKDRIQQIQGINDVEVELTFDPPYSQDMMSEAAKLELGFM