Protein Info for Echvi_3037 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Putative regulator of cell autolysis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details PF06580: His_kinase" amino acids 267 to 343 (77 residues), 87.1 bits, see alignment E=3.7e-29

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G353 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Echvi_3037 Putative regulator of cell autolysis (Echinicola vietnamensis KMM 6221, DSM 17526)
MVAGVFFLIILTNILGATISIGYIGGNSDEMARYFSTIFIPAILFAAFYFMHIKVVPNYQ
TEHKIWKLILFSLLIFIVSWIATGAFYMGAEWGDDMFIPFYFAAVALYVGYMFVVSFLKK
AVKAQRNPNYLVYNISRIGALYIFLLTFLFKFHHFFNPIILIIYAIVIPSLIVIFIYNYF
LVYRKKKKGQTKASKVYYGLLIGLMAGIFFTIAAASGEEEIILVGLVAIALLVLVINPIS
NALFLKYQGYIEKLDKLNVQLEEKTTDLKQLRNQINPHFLFNALNTIYGISLQENAEKTA
ESIQKLGDMMRFMLHENTQETIPLDREIDYLINYVDLQQLRIETQENITIEFNRKEEHCK
GNIAPMLLIPFIENAFKHGISLQKKSWVKINLRCLEGSLHMDIYNSIHRKSEDDPEGKHS
GIGLPNVKQRLQLLYPTRHELVIRENDMEFFVHLSIQLTKS