Protein Info for Echvi_3030 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: methionine aminopeptidase, type I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 TIGR00500: methionine aminopeptidase, type I" amino acids 1 to 248 (248 residues), 236.1 bits, see alignment E=2.2e-74 PF00557: Peptidase_M24" amino acids 12 to 240 (229 residues), 120.6 bits, see alignment E=4.3e-39

Best Hits

Swiss-Prot: 45% identical to MAP12_BACSU: Methionine aminopeptidase 2 (mapB) from Bacillus subtilis (strain 168)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 78% identity to cly:Celly_0358)

MetaCyc: 31% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1S9 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Echvi_3030 methionine aminopeptidase, type I (Echinicola vietnamensis KMM 6221, DSM 17526)
MSITQESDLIGMHRVSEAVGQTLKLMRHYAEPGMSTKELDNYGGVILKEFGARSAPYETY
EFPGFTCISVNQEIAHGIPAKTKILQEGDLINIDVSAELNGFWSDNGGSFVLGQDIYHHQ
PLVDASKEILKRAISNIKGGIKIADIGFVIENEAKKRGYKVIKNLAGHGVGKSLHEKPED
ILNYRVKSNRERFQKNTTVAVETFISTKSTYADTLRDGWILVGNKGGFVTQHEHTILITD
GTPMILTKSNGIWD