Protein Info for Echvi_3028 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted acyl esterases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF06500: FrsA-like" amino acids 154 to 291 (138 residues), 22 bits, see alignment E=2.4e-08 PF02129: Peptidase_S15" amino acids 158 to 288 (131 residues), 41.5 bits, see alignment E=5.6e-14 PF12697: Abhydrolase_6" amino acids 177 to 303 (127 residues), 30.2 bits, see alignment E=2.8e-10 PF00561: Abhydrolase_1" amino acids 185 to 275 (91 residues), 28.4 bits, see alignment E=5.4e-10 PF12146: Hydrolase_4" amino acids 201 to 438 (238 residues), 43.4 bits, see alignment E=1.1e-14 PF01738: DLH" amino acids 202 to 301 (100 residues), 21.6 bits, see alignment E=6e-08 PF00326: Peptidase_S9" amino acids 203 to 287 (85 residues), 25.4 bits, see alignment E=3.8e-09 PF08840: BAAT_C" amino acids 240 to 344 (105 residues), 35.1 bits, see alignment E=6.2e-12

Best Hits

Predicted SEED Role

"FIG01040714: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2P1 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Echvi_3028 Predicted acyl esterases (Echinicola vietnamensis KMM 6221, DSM 17526)
MNFGDMSMYKVGFLLIALLFSIGNSPLKAQYGVQGDWKGVLEVMGQKLPLVFHLKEVDQS
WKGTMDSPAQGATGIPLNDVSVDSMNLHLAVKRFNIRYEGRLEKDTIRGTFSQNGTDFPL
VLWRMAKDDKGMGKRPQEPQGPFDYDQMETSFKNVPAGITLKGTVTKPKGMGPFPAVILV
SGSGPQDRNAEMFGHKPFWVLADYFTRQGIVVLRYDERGVGESTGDFKDATTFDFADDAE
AAMAHLRKFPFVNQLKVGVIGHSEGGMIAWMMAANGKGGSYAVSIAGPVVPIPQLMKQQV
RDMLASVEASDEQKVREEEVVGIIYDVLSHTNDYDSLKIILPERLDKYLKDSGENYTEDE
LQDFVAKYANILNPWFFAFAKINPQEYIKKTEIPVMALFGGKDIQVNGSINAEVLERIKI
ENGKGDFTIKMYPELNHLFQHSGTGALAEYGTIAETFSEEAMADIARWILQQ