Protein Info for Echvi_3017 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Trk-type K+ transport systems, membrane components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 136 to 163 (28 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 236 to 260 (25 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 391 to 415 (25 residues), see Phobius details amino acids 455 to 480 (26 residues), see Phobius details PF02386: TrkH" amino acids 44 to 476 (433 residues), 254.7 bits, see alignment E=7.4e-80

Best Hits

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 45% identity to osp:Odosp_1851)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G334 at UniProt or InterPro

Protein Sequence (483 amino acids)

>Echvi_3017 Trk-type K+ transport systems, membrane components (Echinicola vietnamensis KMM 6221, DSM 17526)
MIHYKAIAKVMGGLLMLLGLLMLPGIAFSFYYKSGDHMPLIYSAFVSMAIGGLLFFSFSK
EDQNIRKREGYLIVALSWIFMSIFGMLPYLVSGTLTNLSDAVFETVSGLTTTGASVLNDI
EALPKGILFWRSMTQWIGGLGIIVLTVAIFPLLGIGGIELFVAESPGPTSDKLHPRIRET
AKRLWYVYVGLTILCAGLYYIGGMDFYDAVNHSLTTLATGGFSTKNASMAYFDVPFIQYV
AILFMFLAGTNFTVIYFGIMGKFDRVWKSDEFKAYVLVVALIIVGLTVPVFLASGFGFEK
AFRDTAFQVVSLITTTGFVTADYTSFGHGLTILFFLLLFVGGCAGSTAGGIKFIRHLTFF
KNTLLEFKRIVHPRAIVTLKINNERVTGKIITHIMIFLLIYLMVFVVGSVLLSIVGYDML
TSFGAVATCLGNVGPAIGNVGPLDNFSFFDPFTKVFLSAIMLLGRLELFTILVLFTPYFW
RAN