Protein Info for Echvi_3011 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Mn2+ and Fe2+ transporters of the NRAMP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 279 to 309 (31 residues), see Phobius details amino acids 321 to 338 (18 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 379 to 403 (25 residues), see Phobius details PF01566: Nramp" amino acids 27 to 378 (352 residues), 266.9 bits, see alignment E=1.4e-83

Best Hits

KEGG orthology group: None (inferred from 48% identity to cly:Celly_3012)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ92 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Echvi_3011 Mn2+ and Fe2+ transporters of the NRAMP family (Echinicola vietnamensis KMM 6221, DSM 17526)
MFKKLTIYVGPGPLVAAAFIGPGTVTVYSMAGVNFGYELLWALLLSMIATITLQEMAGRI
GLITQRWLPHIIKTEIRPKAFAILALGLVIGAIVVGNAAYEAGNLSGAVMGLETFLPEKV
ISPFGVYFRPWPLLTGLFAWILLMRGSYKHIERLMIGTVMIMSVVFMITAVAGKPDLSTL
IAGFVPEVRTDNILTIVALIGTTVVPYNLFLHSALVARMWNSPQSLRYVRADIFISVILG
GLVSMAILVTGTLGNANHVEVVSDLSESLVPLLGPTAPYFLGVGLFSAGITSAITAPLAG
GLVICGCFGWNNRLSAQPMRWTFSIILLLGVIFASLGIKPIQLIAFAQLTNGILLPVLST
FILWMANKTSLMGPFKNHLIANIFGIAIWVITLVLGCKSMLSVIQNWSL