Protein Info for Echvi_3009 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: TIGR00370 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02682: CT_C_D
  • amino acids 7 to 200 (194 residues), 186.7 bits, E=2.1e-59
• TIGR00370: sensor histidine kinase inhibitor, KipI family
  • amino acids 18 to 211 (194 residues), 146.1 bits, E=4.5e-47

Best Hits

KEGG orthology group: None (inferred from 37% identity to gfo:GFO_2122)

Predicted SEED Role

"Allophanate hydrolase 2 subunit 1 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• cyanate degradation (2/3 steps found)
• urea degradation I (2/3 steps found)
• cyanuric acid degradation II (3/5 steps found)
• uracil degradation III (3/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of allantoin degradation in yeast (2/6 steps found)
• superpathway of atrazine degradation (3/8 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54

Sequence Analysis Tools

See L0G115 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Echvi_3009 TIGR00370 family protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MPHLFKYKHISPTILELYWPPSIEESTLMEMMSMKTQIQGIWQQELLEVTMGYHCLSLRF
KSTFQLQDILNELELLAEKSVHSDSSMNRKRWTIPVWYSGKDLDHVASYASMSTDEVISL
HQSSHYLLYFYGFMPGFMYLGGLDQQLFVPRKKQPDPLIEKGAVAIGGKQTGIYPQNSPG
GWHVIGKTPVPLFNVTSDPPIKPQPGDYITFKAVSAEHYQDIISLLKENNYQLDYEEI