Protein Info for Echvi_2999 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: integral membrane protein, TerC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 9 to 319 (311 residues), 352.4 bits, see alignment E=1.2e-109 PF03741: TerC" amino acids 73 to 289 (217 residues), 167.4 bits, see alignment E=1.4e-53

Best Hits

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 60% identity to phe:Phep_1943)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G107 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Echvi_2999 integral membrane protein, TerC family (Echinicola vietnamensis KMM 6221, DSM 17526)
MNYIQEESTTLFIFGILIVGLLLIDLLVFNKKSHKVSMKEALKWSIMWIGLGVLFGGYIY
LDMGLEKASEYYTAFLIEKALSVDNLFVFIMVFRYFNVPDAYQHKVLFYGILGAIFMRAI
FIFFGVTLIDLSYLSPVQIAGHSIRINIVMTLFGGFLIYAGFKSWQSEEENTDDYSRSFG
TKLIHKFFKVDPHYHRDLFFVRINGKRYATQLLVVVAVIEFTDLLFAVDSIPAIFSVSKD
PVILYTSNIFAILGLRALYFLLAGAFDMFHYLKHGLAFILVFIGIKMIIAPIYHFPSTWS
LLIVGFILILCILLSIYRYRTQKQTSSSSN