Protein Info for Echvi_2981 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: pseudouridylate synthase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 10 to 254 (245 residues), 150.4 bits, see alignment E=3.2e-48 PF01416: PseudoU_synth_1" amino acids 12 to 105 (94 residues), 33.2 bits, see alignment E=3.1e-12 amino acids 148 to 260 (113 residues), 74.4 bits, see alignment E=4.7e-25

Best Hits

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70

Use Curated BLAST to search for 4.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ63 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Echvi_2981 pseudouridylate synthase I (Echinicola vietnamensis KMM 6221, DSM 17526)
MKSKPFTYLFYVQYFGYRYHGWQKQPGVKTVQEMLERSFKGWLGHGEFKLLGAGRTDAGV
SCMQGAFELFSATEEQLDGMVKGVNAFLPDDIRLLSVEPIGQDFNIIQDVREKEYRYYFS
YGAKPHPFSAPFVVVFPEQLDVKLMQEAALYFEGLNDFRNFCTKPKSDAVFTREVFASSV
KEYKQPEMEWDLQAPTYCFSVKGKGFMRNQVRLMMGTLYDIGRGKLTIRELQEALKGHRN
VFPLSEKAPARGLVLNQVLFKK