Protein Info for Echvi_2979 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: TIGR03440 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 TIGR03440: ergothioneine biosynthesis protein EgtB" amino acids 4 to 378 (375 residues), 477.5 bits, see alignment E=2.4e-147 PF03781: FGE-sulfatase" amino acids 168 to 302 (135 residues), 80.1 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: None (inferred from 56% identity to mtt:Ftrac_3144)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0Z0 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Echvi_2979 TIGR03440 family protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MTFESYIQIRERSEQLCANLETEDFVIQAAEHVSPAKWHLAHTSWFFETFVLKPYLSDYQ
EFHPDFSFFFNSYYNAVGERTVRNHRGLMTRPTTEEVFDYRGYIDEQMKTVLENGLTEEV
EATILLGLNHEQQHQELLLTDIKYNLWQNPLLPAVINIKEYLKQEEGGWIKMKSGIYEIG
HEGEGFCYDNECSQHKVYLDDFEIGSQLVSNRMYLEFIKAGGYEKPDFWHSDGWTWVQQE
AITGPLYWIKQGGDISCYTLDGKKELDLDAPLAHVSYYEAAAYAEWAGCRLPTEAEWEVA
NRKFSWGNRWEWTNSAYLPYPRYQKAPGAIGEYNGKFMINQMVLRGASVATSPGHSRSTY
RNFFHPQYQWQFTGIRLCKK