Protein Info for Echvi_2977 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 9 to 339 (331 residues), 237.5 bits, see alignment E=9.2e-75 PF01565: FAD_binding_4" amino acids 23 to 145 (123 residues), 82.4 bits, see alignment E=2.7e-27 PF02873: MurB_C" amino acids 217 to 339 (123 residues), 90 bits, see alignment E=9.5e-30

Best Hits

Swiss-Prot: 56% identical to MURB_FLAJ1: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 55% identity to lby:Lbys_3111)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2Z7 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Echvi_2977 UDP-N-acetylenolpyruvoylglucosamine reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNIQENISLKPYNTFQIDKKARFFIEVESVHEIKETLQYAREQNLPVLILGGGSNVLLTK
DVFALVIKISIKGIEVLKEDDSHVWVKAGAGEVWHDFVLHTISHQWAGVENLSLIPGTVG
ASPMQNIGAYGIEIKEVFDHLEAINRDSLETVKIDKETCKFGYRDSIFKNVARDQYIITH
VVYRLSKKPTFNVSYGAIRSTLENMGHQESSYSLKHISDAVIKIRQEKLPDPKKLGNAGS
FFKNPILTKAQFEQLKRDYPTIPFYPQENGVKVPAAWLLEMAGWKGKTFGDVGVHKNQPL
VLVNYGNGDGEAIKALSEKIQRDIKEKFNIHLYPEVNFI