Protein Info for Echvi_2962 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Undecaprenyl-phosphate glucose phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 15 to 460 (446 residues), 412.1 bits, see alignment E=4.2e-127 TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 15 to 452 (438 residues), 386.3 bits, see alignment E=2.6e-119 PF13727: CoA_binding_3" amino acids 81 to 235 (155 residues), 53.8 bits, see alignment E=2.4e-18 PF02397: Bac_transf" amino acids 272 to 452 (181 residues), 217 bits, see alignment E=1.4e-68

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2Y2 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Echvi_2962 Undecaprenyl-phosphate glucose phosphotransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNNINKLVAGFFFIWDTVILGITFLVSLYIFKDTSVQGLDWMLFMGLISIWLVIVKWRKL
YFFDVNGDLSNRILNYVKSSAILVVILGLAYLIFTFPPTFRKVVLSFSIGFPLIGIVTNF
VILSIINRLKNSGGVGKNVLVTGQGEMVNKVNSYFKENPKNGYQVKGVVKYQNVAEPELA
IEGGEYVSDLESMGSYIKENPVDEVIVALPIQYSEEIKKILNTADYYGTRVRFVPDYQNL
LGEDCKVIRQGKMDMVNVRQMPLDDKISAFIKECFDWCFSSLVLLMLSPLFFLIVLLIKL
DSPGPAFYCPERIGKGGKPFRVFKFRTMKENDSTGKASTVENDPRITKVGKVLRKYSIDE
LPQFANVFMGDMSVVGPRPHRTYLNEEFQRSVDKAMVRHYFKPGVTGWAQVNGWRGPTET
AEQKEQRIAHDLWYLKNWSMKLDLKIIYLTIFGRKTHGTAF