Protein Info for Echvi_2958 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: amino acid/peptide transporter (Peptide:H+ symporter), bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 254 to 279 (26 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details amino acids 425 to 449 (25 residues), see Phobius details amino acids 462 to 483 (22 residues), see Phobius details amino acids 498 to 516 (19 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 20 to 523 (504 residues), 389.6 bits, see alignment E=1.3e-120 PF07690: MFS_1" amino acids 40 to 332 (293 residues), 66 bits, see alignment E=2.9e-22 PF00854: PTR2" amino acids 100 to 481 (382 residues), 226.7 bits, see alignment E=4.7e-71

Best Hits

Predicted SEED Role

"Di-/tripeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2H1 at UniProt or InterPro

Protein Sequence (527 amino acids)

>Echvi_2958 amino acid/peptide transporter (Peptide:H+ symporter), bacterial (Echinicola vietnamensis KMM 6221, DSM 17526)
MLENEESNKQQLDRGFDGPSMFGHPRGLMTLFFTEMWERFSYYGMRALLILFMTTAVIDG
GLGFDDKTSGAIYGLYTMGVYLLALPGGWLADRLFGLKKSVWYGGIIIALGHFTMGLPGI
LAMLEGGHVAKDTLSSLDTTSFFLGLILIVVGTGLLKPNISSIVGQLYHEGSSKRDAGFS
IFYMGINIGGFIAPIICSTFAEIDWHLGFGVAGFGMVLGLIQYRLTSGTLKGKGELTDPA
SEVEVAHRRRLRMFTFLTIIVISLVVFLMFQGTIAINAAAIADASYKVIALVAAGFFIYV
ILFGGLDKEEKKKVGVIAILLCFGALFWSGFEQAGSTLNLFAERFTNRHVFGWEIPTGYF
QSANSMFIIIFAPVFAALWVWLAKRHLEPSSPIKFAFGLILLGIGFLVMYFAAKVAAAGS
LAAPTWLMFTYLFHTFGELSLSPVGLSLTTKLAPKKFQGQMMGMWFLSVALGNLVAGIIA
GEASGGSKEAVAEMPDQYMLIVMISIGAGIVLMLITKPIRKLMGNVR