Protein Info for Echvi_2952 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Electron transfer flavoprotein, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF01012: ETF" amino acids 3 to 176 (174 residues), 120.5 bits, see alignment E=7.4e-39 PF00766: ETF_alpha" amino acids 199 to 278 (80 residues), 113.9 bits, see alignment E=2.7e-37

Best Hits

Swiss-Prot: 37% identical to ETFA_BACSU: Electron transfer flavoprotein subunit alpha (etfA) from Bacillus subtilis (strain 168)

KEGG orthology group: K03522, electron transfer flavoprotein alpha subunit (inferred from 71% identity to mtt:Ftrac_3400)

Predicted SEED Role

"Electron transfer flavoprotein, alpha subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2X1 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Echvi_2952 Electron transfer flavoprotein, alpha subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MSILVYIEHAEGTIKKTSLEAVSYASALGEKEGKEVTAVALGAIEEGALAKAGAAGAKKV
LHVADDKLNDGVIQAHASAVAQAFEQAGADTLVLAKSSLGDAVAARLSIKLKAGLASNVV
ALPEEDGGYKVRRSIYTGKAFTDTVITTSNKILAVKKNAVPLKSDGADASVEAFQVNLEE
SDFAAKITATDKATDEISLPEADIVVSGGRGMKGPENWHLIENLAKAMGAATGCSKPVSD
SEWRPHHEHVGQTGVKVAPSLYVAVGISGAIQHLAGVNASKFILVINKDPEAPFFKAADY
GIVGDAFEILPKLTEAVKAIK