Protein Info for Echvi_2946 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glyceraldehyde-3-phosphate dehydrogenase, type I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00044: Gp_dh_N
  • amino acids 4 to 103 (100 residues), 129.6 bits, E=5.1e-42
• TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I
  • amino acids 5 to 324 (320 residues), 429.8 bits, E=3.5e-133
• PF02800: Gp_dh_C
  • amino acids 157 to 312 (156 residues), 203.4 bits, E=1.7e-64

Best Hits

Swiss-Prot: 59% identical to G3P_THEMA: Glyceraldehyde-3-phosphate dehydrogenase (gap) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 63% identity to mtt:Ftrac_0064)

MetaCyc: 59% identical to Gap (Thermotoga maritima)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (13/17 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• Entner-Doudoroff pathway I (7/9 steps found)
• glycerol degradation to butanol (12/16 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• Bifidobacterium shunt (11/15 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• heterolactic fermentation (12/18 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.12

Sequence Analysis Tools

See L0FZ34 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Echvi_2946 glyceraldehyde-3-phosphate dehydrogenase, type I (Echinicola vietnamensis KMM 6221, DSM 17526)
MTKVNVAINGFGRIGRYVFKLLQQHPTIDVVAINDLMDITNLAHLLQYDSIHGKFQAEIT
SLSDALIVNGKTIQIYGEPSPKKLPWEALGVDMVIECTGRFVEKEKAEGHLKAGAKRVII
SAPALGDVPTVVLGVNDALLTGHEAIISNASCTTNCLAPMVKVLEDHFGIEKGFVSTVHS
YTADQNLQDAPHRDLRRARAAACSIIPTTTNAAKAVELVLPHIKGKLHAMAYRVPVPDGS
LTEMNVVLKKETTKEEVNKVMSEAASTTMKGYIEYTEAPLVSVDIIGNPHSCIFDASLTE
ANGSLLKVIGWYDNESGYANRVVDLIEKINCFDQN