Protein Info for Echvi_2944 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 11 to 281 (271 residues), 214.7 bits, see alignment E=8.5e-68 PF01545: Cation_efflux" amino acids 14 to 200 (187 residues), 139 bits, see alignment E=8.5e-45

Best Hits

Swiss-Prot: 31% identical to ZITB_YERPS: Zinc transporter ZitB (zitB) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 64% identity to zpr:ZPR_2290)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0V8 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Echvi_2944 cation diffusion facilitator family transporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MGHHHHHHGHQNIKLAFFLNLGFTILEFFGGLYVNSIAIISDALHDLGDSLSLGLSWYLA
HKSNKKATTIFTFGYKRFSLLGALVNGLILFGGSLFIIKEAITRIIYPEPSDAQGMMVFA
IIGVLVNGFAAYRLSHGKTLNERVISWHLIEDVLGWAAVLVASIVMIFVDTPYIDPVLSL
LITLYILWNVIKRLKETLMIFLQASPSEINEAEIKEKILQFPHVGSLHHVHIWSLDGEKH
VFTAHIKLKEVRDFEEILSLKRNLRKLLKQYPFSHHTIEVELPEEECAMEPMEETNSPVP
PSGHAPD