Protein Info for Echvi_2939 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 75 to 279 (205 residues), 249.9 bits, E=1.1e-78

Best Hits

Swiss-Prot: 55% identical to UGL_BURCM: Ureidoglycolate lyase (Bamb_4846) from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)

KEGG orthology group: None (inferred from 68% identity to zpr:ZPR_4369)

MetaCyc: 50% identical to 2,4-didehydro-3-deoxy-L-fuconate hydrolase (Sphingomonas sp. SKA58)
RXN-12096 [EC: 3.7.1.26]

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

• L-fucose degradation III (4/8 steps found)
• L-rhamnose degradation III (2/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.26

Sequence Analysis Tools

See L0G0V3 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Echvi_2939 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKLLRFGNPGEEKPGIEKANGIRIDCSAFGEDWTEDFLTQDGLNRLTTWLESNEAKCPEI
SSEVRLGPPIKRPSKIICIGLNYKLHAKETGAEVPKQPIIFMKSTTSLSGPNDDIIIPRN
SEKTDWEVELAVMIGKKASYVDKENAMDYVAGYCLLNDVSERDFQLSHGGQWVKGKSNDT
FSPLGPYLVTKDEIKDPQHLRLWLKHNGKMLQDSNTSDMVFDIPTLVSHLSNYMTLLPGD
IISTGTPSGVGMGLTPPTYLKEGDVVELGIDGLGTSRQKAVNYKG