Protein Info for Echvi_2937 in Echinicola vietnamensis KMM 6221, DSM 17526
Annotation: Uncharacterized conserved protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to FUCM_XANCP: L-fucose mutarotase (XCC4070) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
KEGG orthology group: K03534, L-rhamnose mutarotase [EC: 5.1.3.-] (inferred from 65% identity to hhy:Halhy_4140)Predicted SEED Role
"L-fucose mutarotase, type 2"
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 5.1.3.-
Use Curated BLAST to search for 5.1.3.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0G2V5 at UniProt or InterPro
Protein Sequence (110 amino acids)
>Echvi_2937 Uncharacterized conserved protein (Echinicola vietnamensis KMM 6221, DSM 17526) MTKRYTMALDLKDDPTLIAEYEKFHQAVWPEIQKSIKDAGIEVMEIYRWENRLFMIMETT EDFSFEKKAAMDAANPKVREWEDLMWTYQQGLPGVPEGEKWQVMNKIFEL