Protein Info for Echvi_2927 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transketolase, N-terminal subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF13292: DXP_synthase_N" amino acids 2 to 191 (190 residues), 43 bits, see alignment E=7.2e-15 PF00456: Transketolase_N" amino acids 11 to 271 (261 residues), 169.7 bits, see alignment E=1.8e-53 PF09364: XFP_N" amino acids 110 to 221 (112 residues), 27.2 bits, see alignment E=3.6e-10 PF00676: E1_dh" amino acids 117 to 230 (114 residues), 26.4 bits, see alignment E=6.9e-10

Best Hits

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 77% identity to mtt:Ftrac_0981)

Predicted SEED Role

"Transketolase, N-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2U4 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Echvi_2927 Transketolase, N-terminal subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MEKLSTEQLKKTASQVRRDIVRMVHDVQSGHPGASLGCTEFFVALYFNQLKHNNEFSMEG
KGEDLFFLSNGHISPVWYSVLARSGYFNIEELKTFRKIDSRLQGHPAVEEGLPGIRIASG
SLGQGLSVAIGAAQAKKIDGDDGIVYALMGDGEQQEGQIWEAAMYAPHHKVDNLIATIDY
NGQQIDGPTDAVMNLNDLKAKWEAFGWEVIDTLKGNDMESVVSSLEYARTLLGKGKPVLN
LLHTEMGYGVDFMVGTHKWHGIAPNDEQLADALGQLEETLGDY