Protein Info for Echvi_2926 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transketolase, C-terminal subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF02779: Transket_pyr" amino acids 14 to 177 (164 residues), 144.6 bits, see alignment E=3.8e-46 PF02780: Transketolase_C" amino acids 191 to 311 (121 residues), 103.5 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 40% identical to Y4MN_SINFN: Putative uncharacterized transketolase family protein y4mN (NGR_a02450) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 83% identity to mtt:Ftrac_0983)

Predicted SEED Role

"Transketolase, C-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ21 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Echvi_2926 Transketolase, C-terminal subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MEKTLDTKFTYTEKSDTRSGFGDGLLEAGRKNPNVVGLCADLIGSLKMGAFQKEFPERFF
QVGIAEANMMGLAAGMSINGKIPFTGTFANFSTGRVYDQIRQSIAYSEKNVKICASHAGL
TLGEDGATHQILEDLGMMKMLPNMTVINPCDYNQTKAATMAIADYHGPVYLRFGRPKWPI
FTPAGQKFEIGKAWKMIEGKDVTIFATGHLVWEAVVAEAKLREEGISAEVINIHTIKPLD
TEAILESVAKTGCCVTAEEHQYNGGLGDSVAQTLVRNSPAPQEFIGVDDSFGESGKPMEL
LDKYGLDANNIVKAAKKAIGRK