Protein Info for Echvi_2921 in Echinicola vietnamensis KMM 6221, DSM 17526
Updated annotation (from data): 3-keto-alpha-glucoside 1,2-lyase
Rationale: Specifically important in carbon source D-Trehalose dihydrate, which appears to be catabolized via the 3-ketoglycoside pathway. Distantly related to the 3-ketoglycoside lyase BT2157. This protein may be partially redundant with homologs (i.e. Echvi_1840, which is in a conserved cluster with the 3-ketoglycoside pathway starting with lacABC). Echvi_2921 is probably periplasmic.
Original annotation: Domain of Unknown Function (DUF1080).
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 60% identity to zpr:ZPR_1939)Predicted SEED Role
"putative multi-domain protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0FZ16 at UniProt or InterPro
Protein Sequence (251 amino acids)
>Echvi_2921 3-keto-alpha-glucoside 1,2-lyase (Echinicola vietnamensis KMM 6221, DSM 17526) MKLNLLFPVLAGSMLAVPVMAQHDPIQLPPQATEVWEPVPPVVTPGEENHMPPSDAIVLF DGSDLSAWKSVKTGGEAEWTVHDGIFTVKPGTGEIATKEKFGDVQVHIEWKAPDVVKGEG QGRGNSGLFFCERYEVQILDSYQNRTYSNGQAASLYKEGIPLANAMRSPQEWNTYDVFFT APRFNKDGMVISPAYVTVIHNGVLVQNHYEVKGSTAYIGVHKYEAHETELPIKLQDHGNL VNFRNIWVRKL