Protein Info for Echvi_2915 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Amidases related to nicotinamidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF00857: Isochorismatase" amino acids 3 to 201 (199 residues), 100.5 bits, see alignment E=6e-33

Best Hits

Swiss-Prot: 51% identical to PNCA_ECOLI: Nicotinamidase (pncA) from Escherichia coli (strain K12)

KEGG orthology group: K08281, nicotinamidase/pyrazinamidase [EC: 3.5.1.- 3.5.1.19] (inferred from 56% identity to hhy:Halhy_5705)

MetaCyc: 51% identical to nicotinamidase (Escherichia coli K-12 substr. MG1655)
Amidase. [EC: 3.5.1.4]; Nicotinamidase. [EC: 3.5.1.4, 3.5.1.19]

Predicted SEED Role

"Nicotinamidase (EC 3.5.1.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 3.5.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-, 3.5.1.4

Use Curated BLAST to search for 3.5.1.- or 3.5.1.19 or 3.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1H5 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Echvi_2915 Amidases related to nicotinamidase (Echinicola vietnamensis KMM 6221, DSM 17526)
MRALLIVDMQNDFLPGGALAVKDGDKVIPVINKLQEKFDFILATQDWHPADHKSFADNHS
GKEPGEVIKLGGTDQMLWPVHCVQDSEGAQFAKDLNRTNWKKIFKKGLNPLVDSYSGFFD
NKKKEDTGLTAYLHAHNISDLYVTGLAADYCVKFTVLDALKEGFDTYLIADATRAVNLSP
DDYDESLKEMSKSGAEVITSAAISF