Protein Info for Echvi_2913 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 42 (18 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details PF00892: EamA" amino acids 1 to 124 (124 residues), 60.8 bits, see alignment E=8.1e-21 amino acids 137 to 264 (128 residues), 46 bits, see alignment E=3e-16

Best Hits

KEGG orthology group: None (inferred from 58% identity to mtt:Ftrac_3553)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2D9 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Echvi_2913 Predicted permeases (Echinicola vietnamensis KMM 6221, DSM 17526)
MLLAGIFFAIMQVMVKYVPHLPAVEVVFFRSLFSLVASYVILKKQKIPLLGNNKKLLILR
GASGALGLITFFFTLQNIPLASAVTLQYLSPVFTTILGIFIVREKVNPIRFLYFAIAFGG
VLVIEGFDPRISIQYTLIGVSSGFFAGLAYNIIRKLKGSEHPLVIVFYFPLVTLPIVGIW
SYFIWVMPSGWDWLLLLGIGFFTQMAQYFMTMAYQHANLAKITSLNYIGILYALVFGFIF
FGETFNLLTYLGMGLVLIGVILNIRSNK