Protein Info for Echvi_2908 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: succinyl-CoA synthetase, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 TIGR01016: succinate-CoA ligase, beta subunit" amino acids 1 to 401 (401 residues), 477.8 bits, see alignment E=1.3e-147 PF08442: ATP-grasp_2" amino acids 2 to 217 (216 residues), 230.9 bits, see alignment E=1.8e-72 PF00549: Ligase_CoA" amino acids 278 to 398 (121 residues), 116.3 bits, see alignment E=1.6e-37

Best Hits

Swiss-Prot: 68% identical to SUCC_FLAJ1: Succinate--CoA ligase [ADP-forming] subunit beta (sucC) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K01903, succinyl-CoA synthetase beta subunit [EC: 6.2.1.5] (inferred from 81% identity to mtt:Ftrac_0713)

MetaCyc: 42% identical to (ADP-forming) succinyl-CoA ligase beta subunit (Homo sapiens)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2D7 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Echvi_2908 succinyl-CoA synthetase, beta subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MNIHEYQAKEVLKGYGVKIQEGIVAETPEAALEAAKQLNAETGTSWYVIKAQIHAGGRGK
GKIQQTDSNGVVLAKKLDEVPEKAKNILGGTLVTHQTGPEGKNVSKVLVAQDVYYPGDSE
PKEYYLSILLDRAKGCNVIMASTEGGMDIEEVAEKTPEKIIKEWIDPKVGLQGFQARKVA
FALGLSGNALKEMVKFISALYKAYDATDSSQFEINPVLKTSDDQILAVDAKVNLDDNALY
RHRDLAELRDLSEEDPLEVEAGKSDLNYVKLDGNVGCMVNGAGLAMATMDMIKLSGGEPA
NFLDVGGGANATTVEAGFRIILKDPNVKAILINVFGGIVRCDRIASGVVEAYKSIGDIRV
PIIVRLQGTNAEEGAKIIDESGLKVSSAITLKEAAEKVQEVLKNA