Protein Info for Echvi_2890 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details PF13386: DsbD_2" amino acids 6 to 201 (196 residues), 161.6 bits, see alignment E=1.2e-51

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYZ1 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Echvi_2890 Uncharacterized conserved protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MIWTGLILGFLGSFHCLGMCGPIALAVSAADSKRYWWRKLWYNLGRTVTYGLLGLLVGIV
GKGLQLAGIQQWVSIGLGVLIIIFAMLYKRSERALAGGGLYGMVAKVKSSLGFWLKRGGT
YAFFMTGLVNGLLPCGMVYIALLASMALSNPWQGGMYMVAFGLGTVPLLFLLMLGSTLFS
PLWRQRIYGLMPYFAVLIGVLFIIRGMGLGIHFLSPSLGNFEITAGASDMTICK