Protein Info for Echvi_2873 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Carboxypeptidase C (cathepsin A)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF00450: Peptidase_S10" amino acids 50 to 243 (194 residues), 59.1 bits, see alignment E=2.7e-20

Best Hits

KEGG orthology group: None (inferred from 66% identity to mtt:Ftrac_0656)

Predicted SEED Role

"Carboxypeptidase-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0P2 at UniProt or InterPro

Protein Sequence (481 amino acids)

>Echvi_2873 Carboxypeptidase C (cathepsin A) (Echinicola vietnamensis KMM 6221, DSM 17526)
MCFTVWAAQAQQMLHSDSSAVSSHQVTIKGKRVPYTATVGTQPVWDKKGKEVAYLFYTYY
QRSDVEDKTNRPLVVSFNGGPGSASIWMHIAYTGPVLLNIDEEGNPVQPYGYRENPHSIL
DVADIVYVDPVNTGYSRITDKEADRSQFFGVNADVNYLAEWVRTFVTRQNRWASPKFLIG
ESYGTTRVSGLVNRLQNSQWMYFNGVVLVSPTDLGIDREGPVAAANYLPYYAATAWYHGV
LDNGLQQKDLDEILPEVEAFTVNELIPAMVKGGFLEEEKKKALARKMSAYSGLSEKVIRE
HNLAVPTSFFWKELLRDEGLTVGRLDSRYRGVDRQDAGSRYDYDPALSSWNHAFAPAFNH
YMINELDFKTDINYFLFGPVHPWDRSGDQTGENLRSALAENPYLHVLIQSGYYDGGTDYF
NAKYSMWQMDPSGKLKDRLSWKGYRSGHMMYLRSEDLEQANDDIRDFIIKATPAAGSPAK
Y