Protein Info for Echvi_2861 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 6-phosphogluconate dehydrogenase, decarboxylating

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR00873: 6-phosphogluconate dehydrogenase (decarboxylating)" amino acids 5 to 464 (460 residues), 602.9 bits, see alignment E=2.1e-185 PF03446: NAD_binding_2" amino acids 6 to 174 (169 residues), 153.2 bits, see alignment E=6.6e-49 PF00393: 6PGD" amino acids 179 to 464 (286 residues), 394.8 bits, see alignment E=2.6e-122

Best Hits

Swiss-Prot: 54% identical to 6PGD_LACLA: 6-phosphogluconate dehydrogenase, decarboxylating (gnd) from Lactococcus lactis subsp. lactis (strain IL1403)

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 70% identity to zpr:ZPR_2641)

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.44

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2N8 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Echvi_2861 6-phosphogluconate dehydrogenase, decarboxylating (Echinicola vietnamensis KMM 6221, DSM 17526)
MKQFDFGIVGLGVMGKNLLLNMADHGFSVAGLDLDQAKAAALEEGAREGQDVKGFITAEK
FVSSLKRPRAIMLLVPAGKPVDAAIGSLLPLLEKDDIVVDGGNSYFPDTERRFAELAKKN
IHFFGMGISGGEKGARFGPSMMPGGDAQAYERLRPIFEAIAAKVDGEPCVTYLGKGSAGN
YVKMVHNGIEYGIMQLIAETYDIMKKGLGYSDDKIQSIFASWNDTELQSFLVEITGLILQ
KKDDDTGKQLLPLISDQARSKGTGKWTSQNAMDLQAPVPVIDMAVLMRDISKFKEERVAA
SKALKWAGEENVDATADMLKNALYFGMITTYAQGMVQLRLASEEYGYGLNLEEVAKIWRG
GCIIRAACLEDFRKAYKKAPDLANLMLDKEIGEDLVARQKDVREVVKVAVEKGIPAPALM
AALSYFDAYRSDRLSTNVIQAQRDFFGAHQFERIDKEGVFHAQWE