Protein Info for Echvi_2858 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 47% identity to zpr:ZPR_2625)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0M9 at UniProt or InterPro

Protein Sequence (371 amino acids)

>Echvi_2858 Predicted permeases (Echinicola vietnamensis KMM 6221, DSM 17526)
MSIAIQKTLSLLLLIAIGFFLKSKLNKEEHKKGLKIIILNIALPAIIFVALLKIQIQPDL
LFLPILALVFNLLMLVVGKYVLPLYGIDNDTPTMRTLLMLLPSLAPGLSCFPFLVEYLGD
EALAWGALADIGNKVFVLVLTYLLAMQWYYRANKSVNHSGNQKVKGLLLSMLNEPINMVM
IVAIVLLSFGFTLDSLPLFLSDAVLQMKAMMTPLILIFIGVAAVLKWDQLKMIVALLAFR
SGITFIISGLLVTFLPLPNEAAILLAVVFPQSACSFWPFAHMSAVSAMEKKEGNGGETFD
LTLGLNILAVSLPFSTLVILGVFSSGNYFMNPYHIFLGGVTLMVLAAVPVVVQLVKKSNM
SYELSEEEPAE