Protein Info for Echvi_2857 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00155: Aminotran_1_2
  • amino acids 65 to 387 (323 residues), 159.2 bits, E=1.7e-50
• PF00266: Aminotran_5
  • amino acids 150 to 223 (74 residues), 21.6 bits, E=1e-08

Best Hits

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 56% identity to rbi:RB2501_04550)

Predicted SEED Role

"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• L-histidine biosynthesis (10/10 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• L-tyrosine degradation I (4/5 steps found)
• 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• L-tyrosine degradation II (1/2 steps found)
• atromentin biosynthesis (1/2 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• L-phenylalanine degradation II (anaerobic) (1/3 steps found)
• L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
• 4-hydroxybenzoate biosynthesis I (eukaryotes) (2/5 steps found)
• L-phenylalanine degradation VI (reductive Stickland reaction) (2/5 steps found)
• L-tyrosine degradation V (reductive Stickland reaction) (2/5 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (4/9 steps found)
• (S)-reticuline biosynthesis I (3/11 steps found)
• rosmarinic acid biosynthesis I (1/10 steps found)
• superpathway of rosmarinic acid biosynthesis (1/14 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (2/27 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of phenylpropanoids
• Histidine metabolism
• Novobiocin biosynthesis
• Phenylalanine metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.9

Use Curated BLAST to search for 2.6.1.9

Sequence Analysis Tools

See L0G299 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Echvi_2857 Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase (Echinicola vietnamensis KMM 6221, DSM 17526)
MTTKINRRSWLKSSLLAAGGIGLAPSLVAGTTRVSSHVAPMNPQSLLWEHDPMYKDNAPR
LRARLLANENPYGPSKKVVSTISDAVSMGNRYAHSDAATLIEMIAEKEGVTKDHIMLGPG
STDLLEKTAIVRFLEGGNIVSADPSYMSLINTSRRIGATWKPIPLTSDFAHDLDGMAKAV
DSDTKLVYICNPNNPTGSITEAGKLKSFCKTVSAKTPIFVDEAYLEFMDKPEDNTMVGLV
AEGHDVIVARTFSKIHGMAGLRIGYIVAQPERIESITDMVRSTMGLSVTSLKGAIVSVQE
DKFLSECKAMNKECRDYVFSELTAMGYDVIPSSTSFMIFPIQMEGDKFLKSMFAEGVGVR
AYNFLDKPWCRVSMGTMAEMEIFLEAFKKVTA