Protein Info for Echvi_2840 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details PF16927: HisKA_7TM" amino acids 12 to 234 (223 residues), 224.1 bits, see alignment E=6.4e-70 TIGR00229: PAS domain S-box protein" amino acids 240 to 348 (109 residues), 27.8 bits, see alignment E=1.2e-10 PF13188: PAS_8" amino acids 240 to 287 (48 residues), 21 bits, see alignment 7.2e-08 PF00989: PAS" amino acids 240 to 339 (100 residues), 27.7 bits, see alignment E=6.8e-10 PF13426: PAS_9" amino acids 246 to 341 (96 residues), 28 bits, see alignment E=6.7e-10 PF00512: HisKA" amino acids 363 to 424 (62 residues), 29.6 bits, see alignment E=1.8e-10 PF02518: HATPase_c" amino acids 474 to 582 (109 residues), 92.1 bits, see alignment E=9.8e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYV1 at UniProt or InterPro

Protein Sequence (590 amino acids)

>Echvi_2840 PAS domain S-box (Echinicola vietnamensis KMM 6221, DSM 17526)
MEFSLSPYSLSLLVFAVIVLLLAVFLFTRLSKEVRWFGAMMIAVAIWAASDGIMVGMDDL
EAMLWVVDVEYIGITLVPVFWLLFVLKFVGKEAWLNPRWMVCQFIFPVISMVMVWTNGLH
HLHYQRAEVVEINGLFGLLTAKGPWYIIHTSYFYLAIGYGVYLLIKRYFNTKGIYQKQTL
IILFGTMVPWIANILVVFQVEPFNGIDPTPHAFMVTCLIVFGGFLKVGLFDVKPIARNIV
VESMRNGMLVIDGERRIVDVNPCFTKLINKKAEHVIGLHVSRLPFEWQDWERILESEDEL
AVEKMIVVDGVERYFEVSSKILKEGGRKYQGRLILLRDITQFIHDQQRLELQAKELMELN
ATKDRFLSIVSHDLRNPVHSLSQFLEMVEYGWVKDDEFRSMLPSFSKNLKDVSSFMENLL
EWAQTQLKGESVEAVKIDLEEEVEAVVALFKNHLDTKGVQLKIIAGAPTYAFGDLNMMRL
VIRNLISNAIKFCHKGDEIIVKLISKGSEIEVIVEDTGVGISKENVDKIFSSSFFTTTGT
QNEKGTGLGLLLCKDFVEKNDGEIGVESELGKGTRFHFTIPQFEPKMASS