Protein Info for Echvi_2833 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: L-serine dehydratase, iron-sulfur-dependent, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00719: L-serine dehydratase, iron-sulfur-dependent, beta subunit
  • amino acids 4 to 201 (198 residues), 199.4 bits, E=2.8e-63
• PF03315: SDH_beta
  • amino acids 6 to 83 (78 residues), 42.8 bits, E=3.6e-15

Best Hits

Swiss-Prot: 44% identical to SDHAB_BACSU: Probable L-serine dehydratase, beta chain (sdaAB) from Bacillus subtilis (strain 168)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 72% identity to mtt:Ftrac_1031)

Predicted SEED Role

"L-serine dehydratase, beta subunit (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• glycine betaine degradation III (4/7 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• purine nucleobases degradation II (anaerobic) (9/24 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

See L0G0K7 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Echvi_2833 L-serine dehydratase, iron-sulfur-dependent, beta subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MTRKSSVFDMIGPVMIGPSSSHTAGVVRIARAAIKVLGGIPDDAVITFYNSFARTYEGHG
SDKAIIGGLMDLKTDDARIKQAFELAEARGLTYIFKSVGNASVFHPNTIKLNLTKGDRKV
EVIGESLGGGLINIKSIDGFHAEFSAQEHTLIIKADDVSGAIAFITSILAQEQANIATMS
VSRKGKRDMACHVIEMDSGLNAITIKYLESISWIHELIYIPDIDL