Protein Info for Echvi_2832 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF01063: Aminotran_4" amino acids 38 to 248 (211 residues), 147.3 bits, see alignment E=3.3e-47

Best Hits

Predicted SEED Role

"Aminodeoxychorismate lyase (EC 4.1.3.38)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 4.1.3.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G276 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Echvi_2832 Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNSDTFDNDTLLFSPSPKGGYVSAPDHLANRASFFGDGLFETMIFKEGEIRFRDGHWNRI
TEGLQQLKINGRRLQHIGELEAFLVGQFGSHAFLRVRWNIYRSGLGKYSPQENGTDELIS
IQQATSPPKVKQQTFISTSITVPKSPWSHCKTLNALTYVMANIEREEKGMDEVILKDTSN
FISESGIANLFWKKDGTFYTPSLTCSCIAGVSRNALIQHLNHQRIPLIEGEFTEDHLLSA
DQVFTTNVSGIAYLQRIEGKEFDTSPIAEAESLFN