Protein Info for Echvi_2831 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00303: Thymidylat_synt
  • amino acids 2 to 264 (263 residues), 436.7 bits, E=1.3e-135
• TIGR03284: thymidylate synthase
  • amino acids 2 to 85 (84 residues), 146.3 bits, E=5.4e-47
  • amino acids 84 to 264 (181 residues), 329.3 bits, E=1e-102

Best Hits

Swiss-Prot: 76% identical to TYSY_CYTH3: Thymidylate synthase (thyA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 82% identity to fte:Fluta_0846)

MetaCyc: 67% identical to thymidylate synthase (Escherichia coli K-12 substr. MG1655)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (9/9 steps found)
• folate transformations III (E. coli) (8/9 steps found)
• pyrimidine deoxyribonucleosides salvage (5/5 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (7/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (11/14 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• folate transformations II (plants) (8/11 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

See L0G2L0 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Echvi_2831 thymidylate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKQYHQLLQHILDTGVQKGDRTGTGTLSVFGYQMRFDLQEGFPLVTTKKCHLKSIIYELL
WFLKGDTNIKYLKDHKVRIWDEWADENGDLGPVYGYQWRHWPDGKGGEIDQIKNLIHQLK
TNPNSRRLLVSAWNVADVDHMALPPCHTMFQFYVADGKLSCQLYQRSADVFLGVPFNIAS
YALFTMMIAQACDLQPGEFIHTFGDAHLYSNHLEQAKLQLTRECRPLPTMKINPEVKDLF
SFEFEDFELQNYDPHPHIKAEVSV