Protein Info for Echvi_2826 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: CDP-diacylglycerol--serine O-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 55 (23 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 190 to 220 (31 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 6 to 154 (149 residues), 82.5 bits, see alignment E=2.2e-27 TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase" amino acids 12 to 158 (147 residues), 124.9 bits, see alignment E=1.5e-40

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 46% identity to bvu:BVU_1883)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2K6 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Echvi_2826 CDP-diacylglycerol--serine O-phosphatidyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKIKKHIPNTITCMNLASGMAGIYFVLQGNLFAATYFILIAAVFDFLDGMVARLLKVHSE
IGKQLDSLADLVTFGVLPSFVLFQLLKVPFPDGYLPFFAFIIGIQSAMRLAKFNIDTRQS
DRFIGVPTPANALLICTLPFLAEHFAWAGSMIQNRYFLLSLTVVLAFLLTAELPLIALKF
KNLSFGDNVFRYLVIAIGAISVLWLGLAGVPFIILSYILLSLVESRLHPA