Protein Info for Echvi_2817 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Na+/H+ antiporter NhaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 13 to 31 (19 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 80 to 108 (29 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 141 to 167 (27 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 371 to 388 (18 residues), see Phobius details amino acids 452 to 472 (21 residues), see Phobius details TIGR00931: Na+/H+ antiporter NhaC" amino acids 7 to 478 (472 residues), 416.6 bits, see alignment E=6.1e-129 PF03553: Na_H_antiporter" amino acids 166 to 472 (307 residues), 176.2 bits, see alignment E=4.9e-56

Best Hits

KEGG orthology group: K03315, Na+:H+ antiporter, NhaC family (inferred from 67% identity to mtt:Ftrac_0013)

Predicted SEED Role

"Na+/H+ antiporter NhaC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G263 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Echvi_2817 Na+/H+ antiporter NhaC (Echinicola vietnamensis KMM 6221, DSM 17526)
MTKPHQKASLGEAMIPILFLIILLVINIRVFGTDSLSGSNQMVLILSSCVASLIAIFRLK
ISWDTLQKGIVNSIGAAMPSILILLLIGALAGTWLLSGIVPAMIYYGLKILSPGIFLLAA
CVVSAIVSIATGSSWTTVATVGVALLGIGKALGFEEGVIAGAIISGAYFGDKMSPLSDTT
NLAPAMAGTDLFTHIRHMTKTTVPSIVITLIIFGVLGFTIDVSGSVDQVRGISEVISEKF
NISGWLFIVPVLVLGMIIKKVPAVPALLAGALLGGVFAVIFQPQIIEGIAGEPTAGYMYQ
SFKAVMMSLYGDISVTTSNEMVNELLSTGGMAGMLFTIWLIITAMIFGGVMEESGMLQVI
AEAVIRKVHSLGSLIASTAATCVFFNLTTSDQYLAILVPGRMYSDIYRKRGLKGENLSRT
LEDSATVTSVLVPWNTCGATQASVLGVATLTYAPYCFFNIISPFMTVLYGYLKLGINYYS
EEEMREIQKELAV