Protein Info for Echvi_2814 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Kef-type K+ transport systems, membrane components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 27 to 47 (21 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 213 to 246 (34 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details amino acids 351 to 370 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 11 to 370 (360 residues), 203.7 bits, see alignment E=6.6e-64 PF02254: TrkA_N" amino acids 415 to 527 (113 residues), 61.6 bits, see alignment E=1.3e-20 PF02080: TrkA_C" amino acids 590 to 659 (70 residues), 47.7 bits, see alignment E=1.8e-16

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 52% identity to gfo:GFO_1965)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefC" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G192 at UniProt or InterPro

Protein Sequence (663 amino acids)

>Echvi_2814 Kef-type K+ transport systems, membrane components (Echinicola vietnamensis KMM 6221, DSM 17526)
MLPEIVIIFGLATLVIMLFTRLKVPTIIGFLLTGTIAGPYGLSLVNASATVDVLSEIGII
LLLFVIGMEFSLKSLMSIKKAVFVGGSLQVSLTILAATVTAYFFGFDWNVAVFFGFLLAL
SSTAIVLKLLQEMGQVNNLSGKTILAILIFQDIIIVPMMLFTPMLAGESDNVLLSLFFMA
VKGGLVILFTILSAKYLIPQLLFWVAKTRNEELFLLSIIVICFSVAFLTSLLGLSLGLGA
FLAGLIISESEYSHHATGKILPFREIFLSFFFVSVGMLFDVTFLFSHIEIIIGILVLVLV
FKFIMTVVAVRSIGIDFKEAFIVGFSIFQIGEFSLLLAQEGVEIGLIDQNHYQYFLAVSI
LTMAITPFVIKNREKLAFKMLDAPLPQKLKTHLSTSTGNISMANMEGEELSDHLVIIGYG
LNGRNLSKAAKRAKIPYAIIEMNPETVRAEGEKGEPIIYGDASNEMVLKHVNIHLSRVVV
IAISNSDATKSIITAIRLLTQNASIIVRTRYVNEISANLSMGANEVIPEEFETSIEIFTR
VLNKYLIAKDDIEDFTEEVRSHNYEMFRATQNRGRDRLNIDLPEINFVSLKVDRDSGQYI
NKPLKKVNLRENLGVSLVALKREGQTTSHIDGDTKLKFGDIVYVVGKPDGLSEFEKAIGE
KDR