Protein Info for Echvi_2810 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: MFS transporter, sugar porter (SP) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 240 to 264 (25 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details amino acids 334 to 359 (26 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 5 to 431 (427 residues), 311.4 bits, see alignment E=5.3e-97 PF00083: Sugar_tr" amino acids 9 to 434 (426 residues), 317.7 bits, see alignment E=1.4e-98 PF07690: MFS_1" amino acids 13 to 352 (340 residues), 86.1 bits, see alignment E=2.3e-28 amino acids 249 to 426 (178 residues), 35.2 bits, see alignment E=6.7e-13

Best Hits

KEGG orthology group: None (inferred from 53% identity to pat:Patl_3822)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYS7 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Echvi_2810 MFS transporter, sugar porter (SP) family (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNLTTYYAFIVSLTGFLFGFDTAVISGANLPLKALWQTSDWFHGFFIMSVALWGTVIGA
LLGGIPCHHLGRKNTLFWIGVMFLVSALGTALATDPFVFSFYRFVGGVAIGASSIAAPTY
VSEISQAYQRGRRVGLYQINIVSGILVAYVSNYLLQGVGDHNDWRWMLAAEIIPAIIYLA
FILDIPESPRWLILKQKDESAAQKVLKKITTGKIDQLLLSIKHDSLRSKKMKLFSAKNRL
PLFLAGIIAIFNQLSGINFILYYAPEIMEKAGFVTTTSLLGAVCIGFTNLIFTLIGMSLI
DKTGRKQLMLIGSMGYIISLGLVSYGFYDSSSPLFILTSILIFIAAHGIGQGAVIWVFIS
EIFPNKVRAMGQSFGAGVHWGGAAMITLFGAVLIDTLMPFQIFMVFMALMILQFVFVWRY
MPETKGLELENLHSKLAQKLYEKFPSDHKT