Protein Info for Echvi_2804 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): Fructokinase (EC 2.7.1.4)
Rationale: Specifically important for utilizing D-Fructose. Automated validation from mutant phenotype: the predicted function (2.7.1.4) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: Sugar kinases, ribokinase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF00294: PfkB" amino acids 19 to 280 (262 residues), 162.7 bits, see alignment E=6.7e-52

Best Hits

KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 42% identity to sli:Slin_3183)

Predicted SEED Role

"Fructokinase (EC 2.7.1.4)" in subsystem Fructose utilization or Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization or Sucrose utilization or Sucrose utilization Shewanella (EC 2.7.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G184 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Echvi_2804 Fructokinase (EC 2.7.1.4) (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKKAVIFGEMLWDCFPDKQLPGGAPMNVALHLQHLGITTTFISKIGSDSLGADLLSFVQ
KNGLNGDFVQRDTAHETSRVVVDNSDKENIKYEIVKPVAWDFMEWNTAIQEKVDEADVFV
FGSLAARSSQSQNTLFRLLETSTLKVLDINLRPPHYSTKVLERLLKNTDVLKINEDELEI
LIEMSALDKNEEKALSAIVDRYELQLVCMTKGSAGAIIYDGREFYRHPGYQVDVEDTVGS
GDAFLSGFISQYLKGNHPNKILDFACALGALVATQKGGTPRYDTDQITAIQDNNS