Protein Info for Echvi_2797 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Na+/proline symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details amino acids 421 to 439 (19 residues), see Phobius details amino acids 445 to 445 (1 residues), see Phobius details amino acids 447 to 465 (19 residues), see Phobius details PF00474: SSF" amino acids 33 to 429 (397 residues), 186.9 bits, see alignment E=3e-59

Best Hits

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 67% identity to mtt:Ftrac_3252)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G246 at UniProt or InterPro

Protein Sequence (487 amino acids)

>Echvi_2797 Na+/proline symporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MELVDLLIFVIYMIVMLGVGVYFMRKNEGNDDYYVGGRNMGAWHIGLSVVATDVGGGFSI
GLGGLGFAMGLSGSWMLFTGLLGAWLAAVFLIPKVKSNPAFAKFYTFPQIFQYLFNRQVG
IVAGLICFVGYLGFTSSQLLAGAKLASGTFKGLDLDMALMIMGVIAVVYTVMGGLKAVIY
TDTIQWIILLLGFIFIGLPIAYFHVGGWAEISKTLPAEYFSLTNLTWQDLANWGITILPI
WFVGMTLYQRIFASKDVKTAKRAWYIAGIFEWPIMAFMGVSLGVLAKVAFEQGLIAEATE
SLDPEMGLPILLSHVLPAGIMGLMMSAYFSAVLSTADSCLMAASGNLTTDLFGKWLSKQP
EEKSVRYSQLFTLLIGTVALLIAMQMTNVLELMLYSYAFMVSGLLVPILAGLFWNRRNPT
AAIASMIIGGGLTAGLAFSELALPLGLDANLFGLLASLAVFLLLDNSLKIKQRKISEHKS
FSGTGLS