Protein Info for Echvi_2796 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: succinate dehydrogenase and fumarate reductase iron-sulfur protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13085: Fer2_3
  • amino acids 4 to 119 (116 residues), 84.2 bits, E=2.2e-27
• TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein
  • amino acids 9 to 230 (222 residues), 89.7 bits, E=9.8e-30
• PF13237: Fer4_10
  • amino acids 153 to 224 (72 residues), 33.4 bits, E=1.3e-11
• PF13183: Fer4_8
  • amino acids 155 to 227 (73 residues), 38.9 bits, E=3.8e-13
• PF12838: Fer4_7
  • amino acids 157 to 227 (71 residues), 35.2 bits, E=4.8e-12
• PF13187: Fer4_9
  • amino acids 158 to 226 (69 residues), 27.3 bits, E=1.1e-09
• PF13534: Fer4_17
  • amino acids 158 to 228 (71 residues), 29.1 bits, E=4.1e-10

Best Hits

KEGG orthology group: K00240, succinate dehydrogenase iron-sulfur protein [EC: 1.3.99.1] (inferred from 79% identity to mtt:Ftrac_3251)

MetaCyc: 52% identical to succinate dehydrogenase iron-sulfur subunit (Parasynechococcus marenigrum WH 8102)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]; 1.3.5.1 [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle III (animals) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• glycerol-3-phosphate to fumarate electron transfer (1/2 steps found)
• succinate to cytochrome bd oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo quinol oxidase (cyanobacteria, cytoplamic membrane) (1/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• superpathway of glyoxylate bypass and TCA (8/12 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• succinate to chytochrome c oxidase via cytochrome c₆ (thylakoid membrane) (1/3 steps found)
• succinate to cytochrome c oxidase via plastocyanin (thylakoid membrane) (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• TCA cycle VII (acetate-producers) (5/9 steps found)
• mixed acid fermentation (10/16 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• methylaspartate cycle (11/19 steps found)
• reductive TCA cycle II (5/12 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Sequence Analysis Tools

See L0G2I2 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Echvi_2796 succinate dehydrogenase and fumarate reductase iron-sulfur protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MNLTLKVWRQQNSSDKGGFKNYTLTGISEDMSFLEMLDVLNEELSEKGEDPVHFDHDCRE
GICGMCSLYINGKPHGPQQTTTCQLHMRSFKDGDTIVIEPWRAAAFPVVKDLVVDRGSFD
RIIQAGGYVSVNTGGVPDANEIPIPKRIADEAFDAATCIGCGACVAACKNASAMLFTSAK
ISQLAMLPQGKVERKERAEKMVAQMDAEGFGACTNTGACSAECPKGISLTNIARMNREYF
SASASSENV