Protein Info for Echvi_2796 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: succinate dehydrogenase and fumarate reductase iron-sulfur protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF13085: Fer2_3" amino acids 4 to 119 (116 residues), 84.5 bits, see alignment E=1.3e-27 TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein" amino acids 9 to 230 (222 residues), 89.7 bits, see alignment E=9.8e-30 PF13183: Fer4_8" amino acids 155 to 227 (73 residues), 38.3 bits, see alignment E=4.2e-13 PF12838: Fer4_7" amino acids 157 to 227 (71 residues), 35.7 bits, see alignment E=2.4e-12 PF13534: Fer4_17" amino acids 158 to 228 (71 residues), 28.3 bits, see alignment E=5.5e-10

Best Hits

KEGG orthology group: K00240, succinate dehydrogenase iron-sulfur protein [EC: 1.3.99.1] (inferred from 79% identity to mtt:Ftrac_3251)

MetaCyc: 52% identical to succinate dehydrogenase iron-sulfur subunit (Parasynechococcus marenigrum WH 8102)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]; 1.3.5.1 [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2I2 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Echvi_2796 succinate dehydrogenase and fumarate reductase iron-sulfur protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MNLTLKVWRQQNSSDKGGFKNYTLTGISEDMSFLEMLDVLNEELSEKGEDPVHFDHDCRE
GICGMCSLYINGKPHGPQQTTTCQLHMRSFKDGDTIVIEPWRAAAFPVVKDLVVDRGSFD
RIIQAGGYVSVNTGGVPDANEIPIPKRIADEAFDAATCIGCGACVAACKNASAMLFTSAK
ISQLAMLPQGKVERKERAEKMVAQMDAEGFGACTNTGACSAECPKGISLTNIARMNREYF
SASASSENV