Protein Info for Echvi_2794 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 152 to 178 (27 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details TIGR02046: succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family" amino acids 10 to 224 (215 residues), 181.6 bits, see alignment E=7.9e-58

Best Hits

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 58% identity to mtt:Ftrac_3249)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b subunit" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G175 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Echvi_2794 succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family (Echinicola vietnamensis KMM 6221, DSM 17526)
MSWVTKTFTSTLGRKLLMALTGLFLILFLIGHVSGNMLLFKDDGGQAFNEYAKFMTTNPA
VKILSYLTYISIIAHVVYAIILSAKNKKARPIGYAESKASTNSTWNSRNMGILGTIILIF
IVVHLQNFWAEMHWGGIPVVNYESGEYKDLYSVVYGAFSNIGLVALYVVAMAFLGFHLNH
GFASAFQTLGLNHKKYTPAIKFIGTAFSIIVPALFASMPIYIYFSTLN