Protein Info for Echvi_2792 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 85 to 102 (18 residues), see Phobius details PF04134: DCC1-like" amino acids 11 to 120 (110 residues), 117.9 bits, see alignment E=2.8e-38

Best Hits

Swiss-Prot: 46% identical to YUXK_BACSU: Uncharacterized protein YuxK (yuxK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 57% identity to kdi:Krodi_2507)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G242 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Echvi_2792 Uncharacterized protein conserved in bacteria (Echinicola vietnamensis KMM 6221, DSM 17526)
MTKLTDRYDIVLFDGVCNLCNQAVDFIIQRDPKNHFKLASLQDDLSKKLLKGKNLDESYL
DSIVLLQNDQVYYKSRAALEIAKKLNGLWPLLYVFIVIPRFLRDPLYDWIARNRYKWFGK
RETCRFPTEEDKMKFLSKEDLEST